Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 29476..30001 | Replicon | plasmid 2 |
Accession | NZ_LR890406 | ||
Organism | Escherichia coli isolate MSB1_7C-sc-2280317 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | S1PFV8 |
Locus tag | JMW09_RS24935 | Protein ID | WP_001159871.1 |
Coordinates | 29476..29781 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | H9TJP1 |
Locus tag | JMW09_RS24940 | Protein ID | WP_000813630.1 |
Coordinates | 29783..30001 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW09_RS24920 | 25433..26638 | - | 1206 | WP_001442122.1 | AAA family ATPase | - |
JMW09_RS24925 | 27259..27990 | + | 732 | WP_000504263.1 | replication initiation protein | - |
JMW09_RS24930 | 28670..29475 | - | 806 | Protein_29 | phage integrase family protein | - |
JMW09_RS24935 | 29476..29781 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
JMW09_RS24940 | 29783..30001 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
JMW09_RS24945 | 30596..30865 | + | 270 | WP_001554929.1 | hypothetical protein | - |
JMW09_RS24950 | 30853..31449 | + | 597 | WP_001554928.1 | hypothetical protein | - |
JMW09_RS24955 | 31467..31814 | - | 348 | WP_001554927.1 | hypothetical protein | - |
JMW09_RS24960 | 31925..32272 | + | 348 | WP_001554926.1 | hypothetical protein | - |
JMW09_RS24965 | 32290..32716 | - | 427 | Protein_36 | hypothetical protein | - |
JMW09_RS24970 | 32928..33116 | + | 189 | WP_000744815.1 | hypothetical protein | - |
JMW09_RS24975 | 33244..34633 | + | 1390 | Protein_38 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaTEM-1B / tet(A) / aac(3)-IIa / mph(A) / sul1 / qacE / aadA5 | senB | 1..97983 | 97983 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T290907 WP_001159871.1 NZ_LR890406:c29781-29476 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CCE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CEF5 |