Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 29476..30001 Replicon plasmid 2
Accession NZ_LR890406
Organism Escherichia coli isolate MSB1_7C-sc-2280317

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag JMW09_RS24935 Protein ID WP_001159871.1
Coordinates 29476..29781 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag JMW09_RS24940 Protein ID WP_000813630.1
Coordinates 29783..30001 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW09_RS24920 25433..26638 - 1206 WP_001442122.1 AAA family ATPase -
JMW09_RS24925 27259..27990 + 732 WP_000504263.1 replication initiation protein -
JMW09_RS24930 28670..29475 - 806 Protein_29 phage integrase family protein -
JMW09_RS24935 29476..29781 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
JMW09_RS24940 29783..30001 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
JMW09_RS24945 30596..30865 + 270 WP_001554929.1 hypothetical protein -
JMW09_RS24950 30853..31449 + 597 WP_001554928.1 hypothetical protein -
JMW09_RS24955 31467..31814 - 348 WP_001554927.1 hypothetical protein -
JMW09_RS24960 31925..32272 + 348 WP_001554926.1 hypothetical protein -
JMW09_RS24965 32290..32716 - 427 Protein_36 hypothetical protein -
JMW09_RS24970 32928..33116 + 189 WP_000744815.1 hypothetical protein -
JMW09_RS24975 33244..34633 + 1390 Protein_38 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaTEM-1B / tet(A) / aac(3)-IIa / mph(A) / sul1 / qacE / aadA5 senB 1..97983 97983


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T290907 WP_001159871.1 NZ_LR890406:c29781-29476 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT290907 WP_000813630.1 NZ_LR890406:c30001-29783 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References