Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3067782..3068566 | Replicon | chromosome |
Accession | NZ_LR890405 | ||
Organism | Escherichia coli isolate MSB1_7C-sc-2280317 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | JMW09_RS14845 | Protein ID | WP_000613626.1 |
Coordinates | 3068072..3068566 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | L4JCW6 |
Locus tag | JMW09_RS14840 | Protein ID | WP_001110447.1 |
Coordinates | 3067782..3068075 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW09_RS14830 | 3062932..3063891 | - | 960 | WP_000846342.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
JMW09_RS14835 | 3064464..3067649 | + | 3186 | WP_000827427.1 | ribonuclease E | - |
JMW09_RS14840 | 3067782..3068075 | + | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
JMW09_RS14845 | 3068072..3068566 | + | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
JMW09_RS14850 | 3068661..3069614 | - | 954 | WP_001212768.1 | flagellar hook-associated protein FlgL | - |
JMW09_RS14855 | 3069626..3071269 | - | 1644 | WP_000096524.1 | flagellar hook-associated protein FlgK | - |
JMW09_RS14860 | 3071335..3072276 | - | 942 | WP_001309406.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
JMW09_RS14865 | 3072276..3073373 | - | 1098 | WP_000589320.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T290895 WP_000613626.1 NZ_LR890405:3068072-3068566 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|