Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2667441..2668079 | Replicon | chromosome |
| Accession | NZ_LR890405 | ||
| Organism | Escherichia coli isolate MSB1_7C-sc-2280317 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | B7N4J4 |
| Locus tag | JMW09_RS12690 | Protein ID | WP_000813797.1 |
| Coordinates | 2667903..2668079 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | JMW09_RS12685 | Protein ID | WP_076611057.1 |
| Coordinates | 2667441..2667857 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW09_RS12665 | 2662593..2663534 | - | 942 | WP_001251335.1 | ABC transporter permease | - |
| JMW09_RS12670 | 2663535..2664548 | - | 1014 | WP_000220413.1 | ABC transporter ATP-binding protein | - |
| JMW09_RS12675 | 2664566..2665711 | - | 1146 | WP_000047447.1 | ABC transporter substrate-binding protein | - |
| JMW09_RS12680 | 2665956..2667362 | - | 1407 | WP_000760613.1 | PLP-dependent aminotransferase family protein | - |
| JMW09_RS12685 | 2667441..2667857 | - | 417 | WP_076611057.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| JMW09_RS12690 | 2667903..2668079 | - | 177 | WP_000813797.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| JMW09_RS12695 | 2668301..2668531 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| JMW09_RS12700 | 2668623..2670584 | - | 1962 | WP_001309488.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| JMW09_RS12705 | 2670657..2671193 | - | 537 | WP_000429161.1 | DNA-binding transcriptional regulator SutR | - |
| JMW09_RS12710 | 2671246..2672457 | + | 1212 | WP_001323162.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6724.76 Da Isoelectric Point: 11.5666
>T290894 WP_000813797.1 NZ_LR890405:c2668079-2667903 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15251.65 Da Isoelectric Point: 4.5908
>AT290894 WP_076611057.1 NZ_LR890405:c2667857-2667441 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|