Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 154293..155029 | Replicon | plasmid 2 |
| Accession | NZ_LR890396 | ||
| Organism | Klebsiella pneumoniae isolate INF044-sc-2279940 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | JMW67_RS26815 | Protein ID | WP_003026803.1 |
| Coordinates | 154293..154775 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | JMW67_RS26820 | Protein ID | WP_003026799.1 |
| Coordinates | 154763..155029 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW67_RS26800 | 149930..150892 | + | 963 | WP_004152113.1 | M48 family metalloprotease | - |
| JMW67_RS26805 | 150980..152234 | + | 1255 | Protein_154 | IS3 family transposase | - |
| JMW67_RS26810 | 152735..154081 | - | 1347 | WP_020314316.1 | ISNCY family transposase | - |
| JMW67_RS26815 | 154293..154775 | - | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| JMW67_RS26820 | 154763..155029 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| JMW67_RS26825 | 155236..155430 | + | 195 | WP_019725033.1 | hypothetical protein | - |
| JMW67_RS26830 | 155474..155704 | - | 231 | WP_019725034.1 | hypothetical protein | - |
| JMW67_RS26835 | 155718..155921 | - | 204 | WP_019725040.1 | hemolysin expression modulator Hha | - |
| JMW67_RS26840 | 155955..156323 | - | 369 | WP_015065502.1 | hypothetical protein | - |
| JMW67_RS26845 | 156367..156861 | - | 495 | WP_009310053.1 | hypothetical protein | - |
| JMW67_RS26850 | 156892..157464 | - | 573 | WP_015065504.1 | hypothetical protein | - |
| JMW67_RS26855 | 157461..157709 | - | 249 | WP_019725036.1 | hypothetical protein | - |
| JMW67_RS26860 | 158276..158620 | + | 345 | WP_058650054.1 | hypothetical protein | - |
| JMW67_RS26865 | 158728..159363 | - | 636 | WP_016338367.1 | CPBP family intramembrane metalloprotease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | qacE / sul1 / mph(A) / aph(3')-Ia / tet(D) / blaTEM-1B / blaCTX-M-15 / aac(6')-Ib-cr / blaOXA-1 / catA1 | - | 1..227214 | 227214 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T290879 WP_003026803.1 NZ_LR890396:c154775-154293 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |