Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5215858..5216483 | Replicon | chromosome |
Accession | NZ_LR890395 | ||
Organism | Klebsiella pneumoniae isolate INF044-sc-2279940 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | JMW67_RS25670 | Protein ID | WP_002882817.1 |
Coordinates | 5215858..5216241 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | JMW67_RS25675 | Protein ID | WP_004150355.1 |
Coordinates | 5216241..5216483 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW67_RS25655 | 5213224..5214126 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
JMW67_RS25660 | 5214123..5214758 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
JMW67_RS25665 | 5214755..5215684 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
JMW67_RS25670 | 5215858..5216241 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JMW67_RS25675 | 5216241..5216483 | - | 243 | WP_004150355.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
JMW67_RS25680 | 5216688..5217605 | + | 918 | WP_002882812.1 | alpha/beta hydrolase | - |
JMW67_RS25685 | 5217619..5218560 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
JMW67_RS25690 | 5218605..5219042 | - | 438 | WP_002882809.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
JMW67_RS25695 | 5219039..5219899 | - | 861 | WP_002882807.1 | virulence factor BrkB family protein | - |
JMW67_RS25700 | 5219893..5220492 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T290878 WP_002882817.1 NZ_LR890395:c5216241-5215858 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |