Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 54761..55497 Replicon plasmid 2
Accession NZ_LR890392
Organism Klebsiella pneumoniae isolate KSB2_2C-sc-2280354

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag JMW68_RS25510 Protein ID WP_003026803.1
Coordinates 55015..55497 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag JMW68_RS25505 Protein ID WP_003026799.1
Coordinates 54761..55027 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW68_RS25460 50961..51323 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
JMW68_RS25465 51373..51723 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
JMW68_RS25470 52081..52329 + 249 WP_019725036.1 hypothetical protein -
JMW68_RS25475 52326..52898 + 573 WP_015065504.1 hypothetical protein -
JMW68_RS25480 52929..53423 + 495 WP_009310053.1 hypothetical protein -
JMW68_RS25485 53467..53835 + 369 WP_015065502.1 hypothetical protein -
JMW68_RS25490 53869..54072 + 204 WP_019725040.1 hemolysin expression modulator Hha -
JMW68_RS25495 54086..54316 + 231 WP_019725034.1 hypothetical protein -
JMW68_RS25500 54360..54554 - 195 WP_019725033.1 hypothetical protein -
JMW68_RS25505 54761..55027 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
JMW68_RS25510 55015..55497 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
JMW68_RS25515 55705..57051 + 1347 WP_077253535.1 ISNCY family transposase -
JMW68_RS25520 57100..57495 + 396 WP_004143398.1 helix-turn-helix domain-containing protein -
JMW68_RS25525 57643..58897 - 1255 Protein_59 IS3 family transposase -
JMW68_RS25530 58985..59947 - 963 WP_004152113.1 M48 family metalloprotease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / dfrA14 / blaOXA-1 / aac(6')-Ib-cr / tet(A) / qnrB1 - 1..244845 244845


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T290864 WP_003026803.1 NZ_LR890392:55015-55497 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT290864 WP_003026799.1 NZ_LR890392:54761-55027 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References