Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 4969706..4970442 Replicon chromosome
Accession NZ_LR890381
Organism Klebsiella pneumoniae isolate INF148-sc-2279987

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag JMV72_RS24120 Protein ID WP_003026803.1
Coordinates 4969960..4970442 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag JMV72_RS24115 Protein ID WP_003026799.1
Coordinates 4969706..4969972 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV72_RS24070 4965906..4966268 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
JMV72_RS24075 4966318..4966668 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
JMV72_RS24080 4967026..4967274 + 249 WP_019725036.1 hypothetical protein -
JMV72_RS24085 4967271..4967843 + 573 WP_015065504.1 hypothetical protein -
JMV72_RS24090 4967874..4968368 + 495 WP_009310053.1 hypothetical protein -
JMV72_RS24095 4968412..4968780 + 369 WP_015065502.1 hypothetical protein -
JMV72_RS24100 4968814..4969017 + 204 WP_019725040.1 hemolysin expression modulator Hha -
JMV72_RS24105 4969031..4969261 + 231 WP_019725034.1 hypothetical protein -
JMV72_RS24110 4969305..4969499 - 195 WP_019725033.1 hypothetical protein -
JMV72_RS24115 4969706..4969972 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
JMV72_RS24120 4969960..4970442 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
JMV72_RS24125 4970650..4971996 + 1347 WP_077253535.1 ISNCY family transposase -
JMV72_RS24130 4972045..4972440 + 396 WP_004143398.1 helix-turn-helix domain-containing protein -
JMV72_RS24135 4972588..4973842 - 1255 Protein_4736 IS3 family transposase -
JMV72_RS24140 4973930..4974892 - 963 WP_004152113.1 M48 family metalloprotease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element blaCTX-M-15 / qnrB1 / tet(A) - 4850291..5069859 219568


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T290833 WP_003026803.1 NZ_LR890381:4969960-4970442 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT290833 WP_003026799.1 NZ_LR890381:4969706-4969972 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References