Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 21668..22193 | Replicon | plasmid 3 |
Accession | NZ_LR890376 | ||
Organism | Klebsiella pneumoniae isolate INF250-sc-2280154 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | D4HQE7 |
Locus tag | JMW58_RS27365 | Protein ID | WP_013023785.1 |
Coordinates | 21888..22193 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | W8V2V6 |
Locus tag | JMW58_RS27360 | Protein ID | WP_001568025.1 |
Coordinates | 21668..21886 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW58_RS27335 | 17794..18816 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
JMW58_RS27340 | 18801..20363 | - | 1563 | WP_009309907.1 | AAA family ATPase | - |
JMW58_RS27345 | 20437..20853 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | - |
JMW58_RS27350 | 20850..21080 | - | 231 | WP_001261282.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
JMW58_RS27355 | 21037..21498 | + | 462 | WP_160866775.1 | hypothetical protein | - |
JMW58_RS27360 | 21668..21886 | + | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
JMW58_RS27365 | 21888..22193 | + | 306 | WP_013023785.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
JMW58_RS27370 | 22380..23384 | + | 1005 | WP_029497484.1 | hypothetical protein | - |
JMW58_RS27375 | 23582..24361 | + | 780 | WP_029497485.1 | site-specific integrase | - |
JMW58_RS27380 | 24419..24676 | - | 258 | WP_000764642.1 | hypothetical protein | - |
JMW58_RS27385 | 24805..24918 | - | 114 | WP_012540012.1 | hypothetical protein | - |
JMW58_RS27390 | 25552..26307 | + | 756 | WP_012539983.1 | replication initiation protein RepE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..71104 | 71104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11615.30 Da Isoelectric Point: 6.4672
>T290818 WP_013023785.1 NZ_LR890376:21888-22193 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4ZZW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4ZZP8 |