Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 20437..21080 Replicon plasmid 3
Accession NZ_LR890376
Organism Klebsiella pneumoniae isolate INF250-sc-2280154

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag JMW58_RS27345 Protein ID WP_001044770.1
Coordinates 20437..20853 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag JMW58_RS27350 Protein ID WP_001261282.1
Coordinates 20850..21080 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW58_RS27325 15806..16156 + 351 WP_004187110.1 DUF305 domain-containing protein -
JMW58_RS27330 16342..17250 - 909 WP_032425603.1 HNH endonuclease -
JMW58_RS27335 17794..18816 - 1023 WP_000361404.1 helicase UvrD -
JMW58_RS27340 18801..20363 - 1563 WP_009309907.1 AAA family ATPase -
JMW58_RS27345 20437..20853 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
JMW58_RS27350 20850..21080 - 231 WP_001261282.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMW58_RS27355 21037..21498 + 462 WP_160866775.1 hypothetical protein -
JMW58_RS27360 21668..21886 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA -
JMW58_RS27365 21888..22193 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB -
JMW58_RS27370 22380..23384 + 1005 WP_029497484.1 hypothetical protein -
JMW58_RS27375 23582..24361 + 780 WP_029497485.1 site-specific integrase -
JMW58_RS27380 24419..24676 - 258 WP_000764642.1 hypothetical protein -
JMW58_RS27385 24805..24918 - 114 WP_012540012.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..71104 71104


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T290817 WP_001044770.1 NZ_LR890376:c20853-20437 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT290817 WP_001261282.1 NZ_LR890376:c21080-20850 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References