Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4798185..4798701 | Replicon | chromosome |
| Accession | NZ_LR890374 | ||
| Organism | Klebsiella pneumoniae isolate INF250-sc-2280154 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | J2XDK6 |
| Locus tag | JMW58_RS23375 | Protein ID | WP_002886902.1 |
| Coordinates | 4798185..4798469 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | JMW58_RS23380 | Protein ID | WP_002886901.1 |
| Coordinates | 4798459..4798701 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW58_RS23350 | 4793602..4793910 | - | 309 | WP_004178377.1 | PTS sugar transporter subunit IIB | - |
| JMW58_RS23355 | 4793995..4794168 | + | 174 | WP_032410138.1 | hypothetical protein | - |
| JMW58_RS23360 | 4794171..4794914 | + | 744 | WP_021441079.1 | MurR/RpiR family transcriptional regulator | - |
| JMW58_RS23365 | 4795271..4797409 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| JMW58_RS23370 | 4797717..4798181 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| JMW58_RS23375 | 4798185..4798469 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMW58_RS23380 | 4798459..4798701 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| JMW58_RS23385 | 4798779..4800689 | - | 1911 | WP_004152270.1 | BglG family transcription antiterminator | - |
| JMW58_RS23390 | 4800712..4801866 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| JMW58_RS23395 | 4801933..4802673 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T290813 WP_002886902.1 NZ_LR890374:c4798469-4798185 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GMH2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |