Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 738018..738775 | Replicon | chromosome |
| Accession | NZ_LR890369 | ||
| Organism | Klebsiella pneumoniae isolate INF354-sc-2280183 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A1D8JMF4 |
| Locus tag | JMW41_RS03655 | Protein ID | WP_044159004.1 |
| Coordinates | 738293..738775 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A1D8JMH3 |
| Locus tag | JMW41_RS03650 | Protein ID | WP_007372584.1 |
| Coordinates | 738018..738302 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW41_RS03630 | 733410..734132 | + | 723 | WP_013095151.1 | TIGR03761 family integrating conjugative element protein | - |
| JMW41_RS03635 | 734150..736162 | + | 2013 | WP_044159002.1 | DNA topoisomerase III | - |
| JMW41_RS03640 | 736795..737286 | + | 492 | WP_007372582.1 | DUF3577 domain-containing protein | - |
| JMW41_RS03645 | 737362..737862 | + | 501 | WP_007372583.1 | single-stranded DNA-binding protein | - |
| JMW41_RS03650 | 738018..738302 | + | 285 | WP_007372584.1 | DUF1778 domain-containing protein | Antitoxin |
| JMW41_RS03655 | 738293..738775 | + | 483 | WP_044159004.1 | GNAT family N-acetyltransferase | Toxin |
| JMW41_RS03660 | 739008..740294 | + | 1287 | WP_013095156.1 | TcpQ domain-containing protein | - |
| JMW41_RS03665 | 740296..740739 | + | 444 | WP_007372587.1 | type IV pilus biogenesis protein PilM | - |
| JMW41_RS03670 | 740759..742432 | + | 1674 | WP_013095157.1 | PilN family type IVB pilus formation outer membrane protein | - |
| JMW41_RS03675 | 742435..743715 | + | 1281 | WP_176682058.1 | type 4b pilus protein PilO2 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 725888..833324 | 107436 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17693.32 Da Isoelectric Point: 6.9570
>T290785 WP_044159004.1 NZ_LR890369:738293-738775 [Klebsiella pneumoniae]
MEINVTAPALLTEEHVLHSFDCGNAVLDDWLRRRALKNQHLNASRTFVICPEGTACVVGYYSLATGSVSHVDLSRSLRQN
MPDPVPVVLLGRLAVDVSTQGNNFGKWLLNDAVMRVSNLADQVGIKAIMVHAIDERAKAFYEYFGFVQSPVAANTLFYKI
MEINVTAPALLTEEHVLHSFDCGNAVLDDWLRRRALKNQHLNASRTFVICPEGTACVVGYYSLATGSVSHVDLSRSLRQN
MPDPVPVVLLGRLAVDVSTQGNNFGKWLLNDAVMRVSNLADQVGIKAIMVHAIDERAKAFYEYFGFVQSPVAANTLFYKI
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1D8JMF4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1D8JMH3 |