Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 34544..35187 Replicon plasmid 2
Accession NZ_LR890361
Organism Klebsiella pneumoniae isolate INF049-sc-2279950

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag JMW75_RS25715 Protein ID WP_001044770.1
Coordinates 34771..35187 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag JMW75_RS25710 Protein ID WP_001261282.1
Coordinates 34544..34774 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW75_RS25680 30664..31299 + 636 WP_009309912.1 CPBP family intramembrane metalloprotease -
JMW75_RS25685 31407..31751 - 345 WP_009309911.1 hypothetical protein -
JMW75_RS25690 32073..33009 + 937 Protein_35 CAAX protease -
JMW75_RS25695 33200..33640 - 441 WP_047057603.1 hypothetical protein -
JMW75_RS25700 33659..34252 - 594 WP_009309909.1 hypothetical protein -
JMW75_RS25705 34351..34587 - 237 Protein_38 hypothetical protein -
JMW75_RS25710 34544..34774 + 231 WP_001261282.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMW75_RS25715 34771..35187 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
JMW75_RS25720 35261..36823 + 1563 WP_009309907.1 AAA family ATPase -
JMW75_RS25725 36808..37830 + 1023 WP_000361404.1 helicase UvrD -
JMW75_RS25730 38374..39282 + 909 WP_032425603.1 HNH endonuclease -
JMW75_RS25735 39468..39818 - 351 WP_004187110.1 DUF305 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - mrkA / mrkB / mrkC / mrkD / mrkF / mrkJ 1..233670 233670


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T290778 WP_001044770.1 NZ_LR890361:34771-35187 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT290778 WP_001261282.1 NZ_LR890361:34544-34774 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References