Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 23943..24468 Replicon plasmid 2
Accession NZ_LR890361
Organism Klebsiella pneumoniae isolate INF049-sc-2279950

Toxin (Protein)


Gene name ccdB Uniprot ID J5VBT8
Locus tag JMW75_RS25645 Protein ID WP_004197633.1
Coordinates 23943..24248 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A1D8K3R4
Locus tag JMW75_RS25650 Protein ID WP_006788213.1
Coordinates 24250..24468 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW75_RS25610 19522..20502 - 981 WP_020806188.1 IS5-like element ISKpn26 family transposase -
JMW75_RS25615 20605..20718 + 114 WP_014343462.1 hypothetical protein -
JMW75_RS25620 20847..21104 + 258 WP_009310077.1 hypothetical protein -
JMW75_RS25625 21162..21941 - 780 WP_023287113.1 site-specific integrase -
JMW75_RS25630 22139..23155 - 1017 WP_009309921.1 hypothetical protein -
JMW75_RS25635 23189..23524 - 336 WP_009309920.1 hypothetical protein -
JMW75_RS25640 23574..23714 - 141 WP_162898808.1 hypothetical protein -
JMW75_RS25645 23943..24248 - 306 WP_004197633.1 type II toxin-antitoxin system toxin CcdB Toxin
JMW75_RS25650 24250..24468 - 219 WP_006788213.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
JMW75_RS25655 25065..25295 + 231 WP_001261276.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
JMW75_RS25660 25292..25708 + 417 WP_020804312.1 type II toxin-antitoxin system VapC family toxin -
JMW75_RS25665 25749..26627 - 879 WP_032427228.1 restriction endonuclease -
JMW75_RS25670 27289..28566 + 1278 WP_009309915.1 HlyD family secretion protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - mrkA / mrkB / mrkC / mrkD / mrkF / mrkJ 1..233670 233670
- flank IS/Tn - - 19522..20502 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11585.27 Da        Isoelectric Point: 6.4661

>T290776 WP_004197633.1 NZ_LR890361:c24248-23943 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDDSYRLMTTDMASVTASVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8362.31 Da        Isoelectric Point: 4.7405

>AT290776 WP_006788213.1 NZ_LR890361:c24468-24250 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISGLVNRAMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2A5MCG5

Antitoxin

Source ID Structure
AlphaFold DB A0A1D8K3R4

References