Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 4106687..4107393 | Replicon | chromosome |
Accession | NZ_LR890360 | ||
Organism | Klebsiella pneumoniae isolate INF049-sc-2279950 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | JMW75_RS20215 | Protein ID | WP_117037546.1 |
Coordinates | 4107025..4107393 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A485WAM6 |
Locus tag | JMW75_RS20210 | Protein ID | WP_023302278.1 |
Coordinates | 4106687..4107004 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW75_RS20165 | 4101828..4102652 | + | 825 | WP_023302271.1 | DUF945 domain-containing protein | - |
JMW75_RS20170 | 4102861..4103571 | + | 711 | WP_023302272.1 | DeoR family transcriptional regulator | - |
JMW75_RS20175 | 4103597..4104133 | + | 537 | WP_023302273.1 | DUF4339 domain-containing protein | - |
JMW75_RS20180 | 4104175..4104612 | + | 438 | WP_023301392.1 | hypothetical protein | - |
JMW75_RS20185 | 4104679..4105089 | + | 411 | WP_201519709.1 | hypothetical protein | - |
JMW75_RS20190 | 4105167..4105403 | + | 237 | WP_032410024.1 | DUF905 domain-containing protein | - |
JMW75_RS20195 | 4105490..4105948 | + | 459 | WP_023302275.1 | antirestriction protein | - |
JMW75_RS20200 | 4105957..4106439 | + | 483 | WP_023302276.1 | RadC family protein | - |
JMW75_RS20205 | 4106448..4106669 | + | 222 | WP_023302277.1 | DUF987 domain-containing protein | - |
JMW75_RS20210 | 4106687..4107004 | + | 318 | WP_023302278.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
JMW75_RS20215 | 4107025..4107393 | + | 369 | WP_117037546.1 | TA system toxin CbtA family protein | Toxin |
JMW75_RS20220 | 4107390..4107731 | + | 342 | WP_024622904.1 | hypothetical protein | - |
JMW75_RS20225 | 4107854..4110499 | - | 2646 | WP_024622905.1 | LuxR family transcriptional regulator | - |
JMW75_RS20230 | 4110873..4111832 | + | 960 | WP_023302280.1 | thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13669.85 Da Isoelectric Point: 7.2897
>T290771 WP_117037546.1 NZ_LR890360:4107025-4107393 [Klebsiella pneumoniae]
MKNLPATISQAAKPCMSPVAVWQMLLTHLLEQHYGLMLSDTPFSDEAVIQEHIDAGITLANAVNFLVEKYELVRIDRCGF
SSQVQAPYLTATDILHARKACGLMSRYSYREVSNIVLSRSRI
MKNLPATISQAAKPCMSPVAVWQMLLTHLLEQHYGLMLSDTPFSDEAVIQEHIDAGITLANAVNFLVEKYELVRIDRCGF
SSQVQAPYLTATDILHARKACGLMSRYSYREVSNIVLSRSRI
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|