Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 3941594..3942273 | Replicon | chromosome |
| Accession | NZ_LR890349 | ||
| Organism | Escherichia coli isolate MSB1_9D-sc-2280338 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | JMW03_RS19225 | Protein ID | WP_016246873.1 |
| Coordinates | 3941932..3942273 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | - |
| Locus tag | JMW03_RS19220 | Protein ID | WP_016246874.1 |
| Coordinates | 3941594..3941911 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW03_RS19175 | 3937032..3937853 | + | 822 | WP_016246877.1 | DUF945 domain-containing protein | - |
| JMW03_RS19180 | 3938070..3938771 | + | 702 | WP_137474786.1 | WYL domain-containing protein | - |
| JMW03_RS19185 | 3938812..3939048 | + | 237 | WP_001144031.1 | hypothetical protein | - |
| JMW03_RS19190 | 3939048..3939491 | + | 444 | WP_001547764.1 | phage transcriptional regulator | - |
| JMW03_RS19195 | 3939514..3939981 | + | 468 | WP_001547765.1 | hypothetical protein | - |
| JMW03_RS19200 | 3940058..3940297 | + | 240 | WP_000194654.1 | DUF905 domain-containing protein | - |
| JMW03_RS19205 | 3940395..3940853 | + | 459 | WP_000211838.1 | antirestriction protein | - |
| JMW03_RS19210 | 3940869..3941345 | + | 477 | WP_000811693.1 | RadC family protein | - |
| JMW03_RS19215 | 3941354..3941575 | + | 222 | WP_016246875.1 | DUF987 domain-containing protein | - |
| JMW03_RS19220 | 3941594..3941911 | + | 318 | WP_016246874.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| JMW03_RS19225 | 3941932..3942273 | + | 342 | WP_016246873.1 | TA system toxin CbtA family protein | Toxin |
| JMW03_RS19235 | 3942845..3944098 | - | 1254 | WP_201514041.1 | glutamate-5-semialdehyde dehydrogenase | - |
| JMW03_RS19240 | 3944110..3945213 | - | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
| JMW03_RS19245 | 3945501..3946556 | + | 1056 | WP_000749881.1 | phosphoporin PhoE | - |
| JMW03_RS19250 | 3946595..3946996 | - | 402 | WP_000174677.1 | sigma factor-binding protein Crl | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | gmhA/lpcA / rhs/PAAR | 3934158..3970884 | 36726 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12987.05 Da Isoelectric Point: 10.2764
>T290743 WP_016246873.1 NZ_LR890349:3941932-3942273 [Escherichia coli]
MKTLPATTQRAAKPCLAPVAVWQMLLTRLLKQHYGLTLNDTPFSEERVIQEHIDAGITLADAVNFLVEKYELVRIDRKGF
NWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
MKTLPATTQRAAKPCLAPVAVWQMLLTRLLKQHYGLTLNDTPFSEERVIQEHIDAGITLADAVNFLVEKYELVRIDRKGF
NWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|