Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 3906897..3907522 | Replicon | chromosome |
Accession | NZ_LR890343 | ||
Organism | Klebsiella pneumoniae isolate KSB2_2B-sc-2280339 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | JMW06_RS18755 | Protein ID | WP_021312635.1 |
Coordinates | 3906897..3907280 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | JMW06_RS18760 | Protein ID | WP_004150355.1 |
Coordinates | 3907280..3907522 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW06_RS18740 | 3904263..3905165 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
JMW06_RS18745 | 3905162..3905797 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
JMW06_RS18750 | 3905794..3906723 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
JMW06_RS18755 | 3906897..3907280 | - | 384 | WP_021312635.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JMW06_RS18760 | 3907280..3907522 | - | 243 | WP_004150355.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
JMW06_RS18765 | 3907727..3908644 | + | 918 | WP_004178029.1 | alpha/beta hydrolase | - |
JMW06_RS18770 | 3908658..3909598 | - | 941 | Protein_3666 | fatty acid biosynthesis protein FabY | - |
JMW06_RS18775 | 3909643..3910080 | - | 438 | WP_002882809.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
JMW06_RS18780 | 3910077..3910937 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
JMW06_RS18785 | 3910931..3911530 | - | 600 | WP_040148118.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14349.56 Da Isoelectric Point: 7.3178
>T290726 WP_021312635.1 NZ_LR890343:c3907280-3906897 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVATPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVATPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|