Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 19991..20592 Replicon plasmid 3
Accession NZ_LR890336
Organism Escherichia coli isolate MINF_9A-sc-2280436

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag JMW07_RS25715 Protein ID WP_001216034.1
Coordinates 20212..20592 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A2A2XEG6
Locus tag JMW07_RS25710 Protein ID WP_001697569.1
Coordinates 19991..20212 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW07_RS25660 15226..15414 + 189 WP_000797279.1 hypothetical protein -
JMW07_RS25665 15416..15594 + 179 Protein_23 hypothetical protein -
JMW07_RS25670 15928..16392 + 465 WP_023146892.1 hypothetical protein -
JMW07_RS25675 16394..16603 + 210 WP_005025300.1 hypothetical protein -
JMW07_RS25680 16600..17487 + 888 WP_063612277.1 DUF551 domain-containing protein -
JMW07_RS25685 17570..17803 + 234 WP_000516537.1 hypothetical protein -
JMW07_RS25690 17982..18275 + 294 WP_001677496.1 hypothetical protein -
JMW07_RS25695 18282..18656 + 375 WP_000988656.1 hypothetical protein -
JMW07_RS25700 18638..19297 + 660 WP_064638621.1 hypothetical protein -
JMW07_RS25705 19382..19846 + 465 WP_001697568.1 hypothetical protein -
JMW07_RS25710 19991..20212 + 222 WP_001697569.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMW07_RS25715 20212..20592 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMW07_RS25720 20597..20776 + 180 WP_001697572.1 hypothetical protein -
JMW07_RS25725 20804..21847 + 1044 WP_001697573.1 DUF968 domain-containing protein -
JMW07_RS25730 21936..22388 + 453 WP_001326849.1 late promoter-activating protein -
JMW07_RS25735 22474..23667 + 1194 WP_053287785.1 hypothetical protein -
JMW07_RS25740 23667..25151 + 1485 WP_000124155.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..98796 98796


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T290713 WP_001216034.1 NZ_LR890336:20212-20592 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8163.13 Da        Isoelectric Point: 4.7708

>AT290713 WP_001697569.1 NZ_LR890336:19991-20212 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFETYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A2A2XEG6

References