Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 117207..117732 | Replicon | plasmid 2 |
Accession | NZ_LR890335 | ||
Organism | Escherichia coli isolate MINF_9A-sc-2280436 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | JMW07_RS25445 | Protein ID | WP_001159868.1 |
Coordinates | 117427..117732 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | JMW07_RS25440 | Protein ID | WP_000813634.1 |
Coordinates | 117207..117425 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW07_RS25410 | 112600..113016 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
JMW07_RS25415 | 113013..113243 | - | 231 | WP_001261278.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
JMW07_RS25420 | 113508..114008 | + | 501 | WP_000528931.1 | hypothetical protein | - |
JMW07_RS25425 | 114021..114794 | + | 774 | WP_000905949.1 | hypothetical protein | - |
JMW07_RS25430 | 114961..116094 | + | 1134 | WP_001542067.1 | DUF3800 domain-containing protein | - |
JMW07_RS25435 | 116128..116640 | - | 513 | WP_000151784.1 | hypothetical protein | - |
JMW07_RS25440 | 117207..117425 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
JMW07_RS25445 | 117427..117732 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
JMW07_RS25450 | 117733..118539 | + | 807 | WP_000016982.1 | site-specific integrase | - |
JMW07_RS25455 | 119313..120068 | + | 756 | WP_024946706.1 | replication initiation protein RepE | - |
JMW07_RS25460 | 120502..121199 | - | 698 | Protein_153 | IS1 family transposase | - |
JMW07_RS25465 | 121555..122469 | + | 915 | WP_000949004.1 | iron/manganese ABC transporter substrate-binding protein SitA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..139312 | 139312 | |
- | flank | IS/Tn | sitABCD | - | 120502..125004 | 4502 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T290712 WP_001159868.1 NZ_LR890335:117427-117732 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|