Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 107737..108380 Replicon plasmid 2
Accession NZ_LR890335
Organism Escherichia coli isolate MINF_9A-sc-2280436

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag JMW07_RS25395 Protein ID WP_001034044.1
Coordinates 107737..108153 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag JMW07_RS25400 Protein ID WP_001261286.1
Coordinates 108150..108380 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW07_RS25375 102739..103905 - 1167 WP_000772446.1 plasmid-partitioning protein SopA -
JMW07_RS25380 104139..104836 + 698 Protein_137 IS1 family transposase -
JMW07_RS25385 105090..106112 - 1023 WP_000361402.1 helicase UvrD -
JMW07_RS25390 106097..107662 - 1566 WP_001128474.1 AAA family ATPase -
JMW07_RS25395 107737..108153 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
JMW07_RS25400 108150..108380 - 231 WP_001261286.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMW07_RS25405 108761..112555 + 3795 WP_001144732.1 hypothetical protein -
JMW07_RS25410 112600..113016 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
JMW07_RS25415 113013..113243 - 231 WP_001261278.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 / sitABCD iucA / iucB / iucC / iucD / iutA 1..139312 139312
- flank IS/Tn - - 104333..104836 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T290710 WP_001034044.1 NZ_LR890335:c108153-107737 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT290710 WP_001261286.1 NZ_LR890335:c108380-108150 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References