Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4029394..4030214 | Replicon | chromosome |
Accession | NZ_LR890334 | ||
Organism | Escherichia coli isolate MINF_9A-sc-2280436 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | B6I030 |
Locus tag | JMW07_RS19365 | Protein ID | WP_001054379.1 |
Coordinates | 4029957..4030214 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | - |
Locus tag | JMW07_RS19360 | Protein ID | WP_000123957.1 |
Coordinates | 4029394..4029945 (-) | Length | 184 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW07_RS19330 | 4025088..4026401 | - | 1314 | WP_000460845.1 | galactitol-specific PTS transporter subunit IIC | - |
JMW07_RS19335 | 4026413..4026691 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
JMW07_RS19340 | 4026688..4027809 | - | 1122 | WP_000010833.1 | M42 family metallopeptidase | - |
JMW07_RS19345 | 4028054..4028170 | - | 117 | Protein_3777 | VOC family protein | - |
JMW07_RS19350 | 4028208..4028468 | - | 261 | WP_000077645.1 | hypothetical protein | - |
JMW07_RS19355 | 4028596..4029342 | - | 747 | WP_000354249.1 | class I SAM-dependent methyltransferase | - |
JMW07_RS19360 | 4029394..4029945 | - | 552 | WP_000123957.1 | N-acetyltransferase | Antitoxin |
JMW07_RS19365 | 4029957..4030214 | - | 258 | WP_001054379.1 | YjhX family toxin | Toxin |
JMW07_RS19370 | 4030591..4030767 | - | 177 | Protein_3782 | GNAT family N-acetyltransferase | - |
JMW07_RS19375 | 4030753..4031850 | + | 1098 | Protein_3783 | DNA helicase | - |
JMW07_RS19380 | 4032433..4033413 | - | 981 | WP_000991462.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
JMW07_RS19385 | 4033477..4034583 | - | 1107 | WP_001295733.1 | N-acetylneuraminate epimerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9568.07 Da Isoelectric Point: 11.1381
>T290697 WP_001054379.1 NZ_LR890334:c4030214-4029957 [Escherichia coli]
MNLSRQEQRTLHVLAKGGRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
MNLSRQEQRTLHVLAKGGRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20358.34 Da Isoelectric Point: 6.4182
>AT290697 WP_000123957.1 NZ_LR890334:c4029945-4029394 [Escherichia coli]
MTAHHFTFQITDESDASDIREVETRAFGFSKEADLTASLLEDESARPALSLLARHEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTA
QPMNVTGHIQCAQALMKPEHWRE
MTAHHFTFQITDESDASDIREVETRAFGFSKEADLTASLLEDESARPALSLLARHEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTA
QPMNVTGHIQCAQALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|