Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 3945314..3945909 | Replicon | chromosome |
Accession | NZ_LR890334 | ||
Organism | Escherichia coli isolate MINF_9A-sc-2280436 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | V0SXT4 |
Locus tag | JMW07_RS18980 | Protein ID | WP_000239581.1 |
Coordinates | 3945559..3945909 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | JMW07_RS18975 | Protein ID | WP_001223213.1 |
Coordinates | 3945314..3945565 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW07_RS18965 | 3940979..3944758 | + | 3780 | WP_201519824.1 | translocation/assembly module TamB | - |
JMW07_RS18970 | 3944761..3945102 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
JMW07_RS18975 | 3945314..3945565 | + | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
JMW07_RS18980 | 3945559..3945909 | + | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
JMW07_RS18985 | 3945988..3946518 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
JMW07_RS18990 | 3946828..3947784 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
JMW07_RS18995 | 3947917..3949419 | + | 1503 | WP_022646474.1 | sugar ABC transporter ATP-binding protein | - |
JMW07_RS19000 | 3949433..3950455 | + | 1023 | WP_001298067.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T290696 WP_000239581.1 NZ_LR890334:3945559-3945909 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|