Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PanAT/DUF4065(antitoxin) |
Location | 3718484..3719472 | Replicon | chromosome |
Accession | NZ_LR890334 | ||
Organism | Escherichia coli isolate MINF_9A-sc-2280436 |
Toxin (Protein)
Gene name | panT | Uniprot ID | - |
Locus tag | JMW07_RS17780 | Protein ID | WP_014640052.1 |
Coordinates | 3719086..3719472 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | panA | Uniprot ID | A0A0J5Z6D5 |
Locus tag | JMW07_RS17775 | Protein ID | WP_000458584.1 |
Coordinates | 3718484..3719056 (+) | Length | 191 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW07_RS17745 | 3713554..3714162 | + | 609 | WP_000646078.1 | transcriptional repressor LexA | - |
JMW07_RS17750 | 3714235..3715560 | + | 1326 | WP_001361471.1 | MATE family efflux transporter DinF | - |
JMW07_RS17755 | 3715676..3715885 | + | 210 | WP_001296638.1 | CsbD family protein | - |
JMW07_RS17760 | 3715927..3716442 | - | 516 | WP_000416263.1 | zinc uptake transcriptional repressor Zur | - |
JMW07_RS17765 | 3716760..3717764 | + | 1005 | WP_022646425.1 | DUF2713 family protein | - |
JMW07_RS17770 | 3718126..3718248 | + | 123 | WP_001300034.1 | hypothetical protein | - |
JMW07_RS17775 | 3718484..3719056 | + | 573 | WP_000458584.1 | SocA family protein | Antitoxin |
JMW07_RS17780 | 3719086..3719472 | + | 387 | WP_014640052.1 | hypothetical protein | Toxin |
JMW07_RS17785 | 3719512..3719685 | + | 174 | WP_000390072.1 | hypothetical protein | - |
JMW07_RS17790 | 3719733..3720014 | - | 282 | WP_001093916.1 | pyocin activator PrtN family protein | - |
JMW07_RS17795 | 3720051..3720623 | - | 573 | WP_001061348.1 | 3'-5' exoribonuclease | - |
JMW07_RS17800 | 3720623..3721453 | - | 831 | WP_201519818.1 | hypothetical protein | - |
JMW07_RS17805 | 3721453..3721815 | - | 363 | WP_001565177.1 | phage protein | - |
JMW07_RS17810 | 3721806..3722342 | - | 537 | WP_000008200.1 | 5'-deoxynucleotidase | - |
JMW07_RS17815 | 3722470..3723294 | - | 825 | WP_089438609.1 | DUF2303 family protein | - |
JMW07_RS17820 | 3723360..3723722 | - | 363 | WP_000135682.1 | hypothetical protein | - |
JMW07_RS17825 | 3723737..3724047 | - | 311 | Protein_3478 | hypothetical protein | - |
JMW07_RS17830 | 3724160..3724405 | + | 246 | WP_000141753.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3713554..3760264 | 46710 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14465.40 Da Isoelectric Point: 5.4833
>T290694 WP_014640052.1 NZ_LR890334:3719086-3719472 [Escherichia coli]
VLAPTGPCNHLHVICNDPVYYPVNDCYCVLVVNISSIKDGVPHDPSCVLNSGDHRFIKHPSYVVYAEAIIWRVDNMVRKQ
RSGEISVHDDMPEATFNRILDGFDISDEVTPKNLKFKNKYCVSSIDDE
VLAPTGPCNHLHVICNDPVYYPVNDCYCVLVVNISSIKDGVPHDPSCVLNSGDHRFIKHPSYVVYAEAIIWRVDNMVRKQ
RSGEISVHDDMPEATFNRILDGFDISDEVTPKNLKFKNKYCVSSIDDE
Download Length: 387 bp
Antitoxin
Download Length: 191 a.a. Molecular weight: 21973.21 Da Isoelectric Point: 6.0283
>AT290694 WP_000458584.1 NZ_LR890334:3718484-3719056 [Escherichia coli]
MFCEEKVAQMAAYLLLKRGGRMAYLKLMKLLYLSNRQSILKHGRMIGEDSLYSMKFGPVMSNTLNLIRGKAEGIGDYWYN
LIETNGHNVSLRSDPREMDADEVFDELSRADIRILDEIYSRYGHMNRFDLANMTHLESVCPEWHDPGNSRKPIDLKEMLI
SEGKSEDEANRIIGKMEESQKLKEFSLQLS
MFCEEKVAQMAAYLLLKRGGRMAYLKLMKLLYLSNRQSILKHGRMIGEDSLYSMKFGPVMSNTLNLIRGKAEGIGDYWYN
LIETNGHNVSLRSDPREMDADEVFDELSRADIRILDEIYSRYGHMNRFDLANMTHLESVCPEWHDPGNSRKPIDLKEMLI
SEGKSEDEANRIIGKMEESQKLKEFSLQLS
Download Length: 573 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|