Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 3116285..3116897 | Replicon | chromosome |
Accession | NZ_LR890334 | ||
Organism | Escherichia coli isolate MINF_9A-sc-2280436 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | U9YXE2 |
Locus tag | JMW07_RS15035 | Protein ID | WP_000833473.1 |
Coordinates | 3116712..3116897 (-) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A0A1AGA0 |
Locus tag | JMW07_RS15030 | Protein ID | WP_022646255.1 |
Coordinates | 3116285..3116695 (-) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW07_RS15015 | 3111742..3112557 | - | 816 | WP_022646253.1 | AraC family transcriptional regulator | - |
JMW07_RS15020 | 3112783..3114183 | + | 1401 | WP_001600688.1 | MFS transporter | - |
JMW07_RS15025 | 3114194..3116173 | + | 1980 | WP_022646254.1 | glycoside hydrolase family 127 protein | - |
JMW07_RS15030 | 3116285..3116695 | - | 411 | WP_022646255.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
JMW07_RS15035 | 3116712..3116897 | - | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
JMW07_RS15040 | 3117370..3118449 | + | 1080 | WP_000061477.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
JMW07_RS15045 | 3118490..3120028 | - | 1539 | WP_000183976.1 | aldehyde dehydrogenase AldB | - |
JMW07_RS15050 | 3120136..3121431 | - | 1296 | WP_000985736.1 | Fic family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T290692 WP_000833473.1 NZ_LR890334:c3116897-3116712 [Escherichia coli]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15214.08 Da Isoelectric Point: 4.4482
>AT290692 WP_022646255.1 NZ_LR890334:c3116695-3116285 [Escherichia coli]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALAAHFETLCEMDEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALAAHFETLCEMDEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | U9YXE2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A1AGA0 |