Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 52351..52876 | Replicon | plasmid 2 |
Accession | NZ_LR890327 | ||
Organism | Escherichia coli isolate MINF_1A-sc-2280431 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | JMV91_RS25515 | Protein ID | WP_001159868.1 |
Coordinates | 52571..52876 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | JMV91_RS25510 | Protein ID | WP_000813634.1 |
Coordinates | 52351..52569 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV91_RS25485 | 47460..48329 | - | 870 | WP_001586225.1 | hypothetical protein | - |
JMV91_RS25490 | 48331..49233 | - | 903 | WP_024187432.1 | hypothetical protein | - |
JMV91_RS25495 | 49234..49419 | - | 186 | WP_001586223.1 | hypothetical protein | - |
JMV91_RS25500 | 49712..50644 | - | 933 | WP_000991831.1 | hypothetical protein | - |
JMV91_RS25505 | 50648..51643 | - | 996 | WP_000246635.1 | hypothetical protein | - |
JMV91_RS25510 | 52351..52569 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
JMV91_RS25515 | 52571..52876 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
JMV91_RS25520 | 52877..53683 | + | 807 | WP_000016982.1 | site-specific integrase | - |
JMV91_RS25525 | 54457..55212 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
JMV91_RS25530 | 55800..56966 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | tet(B) / aadA5 / qacE / sul1 / mph(A) / aac(3)-IId / sul2 / aph(3'')-Ib / aph(6)-Id | - | 1..98336 | 98336 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T290671 WP_001159868.1 NZ_LR890327:52571-52876 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|