Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 38614..39208 Replicon plasmid 2
Accession NZ_LR890327
Organism Escherichia coli isolate MINF_1A-sc-2280431

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag JMV91_RS25445 Protein ID WP_001403920.1
Coordinates 38614..38889 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID G3CAJ1
Locus tag JMV91_RS25450 Protein ID WP_001261274.1
Coordinates 38978..39208 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV91_RS25405 33733..34001 + 269 Protein_43 type II toxin-antitoxin system ParD family antitoxin -
JMV91_RS25410 34117..34278 + 162 WP_001440647.1 type II toxin-antitoxin system RelE/ParE family toxin -
JMV91_RS25415 34345..34527 + 183 WP_042004909.1 hypothetical protein -
JMV91_RS25420 34648..35388 + 741 WP_001586233.1 tyrosine-type recombinase/integrase -
JMV91_RS25425 35711..36700 - 990 WP_123002471.1 RepB family plasmid replication initiator protein -
JMV91_RS25430 37588..37857 + 270 WP_001275013.1 DUF1778 domain-containing protein -
JMV91_RS25435 37861..38391 + 531 WP_000348883.1 GNAT family N-acetyltransferase -
JMV91_RS25440 38392..38609 + 218 Protein_50 transposase -
JMV91_RS25445 38614..38889 - 276 WP_001403920.1 type II toxin-antitoxin system VapC family toxin Toxin
JMV91_RS25450 38978..39208 - 231 WP_001261274.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMV91_RS25455 39407..42028 - 2622 WP_001586230.1 hypothetical protein -
JMV91_RS25460 42419..42904 + 486 WP_001403958.1 hypothetical protein -
JMV91_RS25465 42933..43705 + 773 Protein_55 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(B) / aadA5 / qacE / sul1 / mph(A) / aac(3)-IId / sul2 / aph(3'')-Ib / aph(6)-Id - 1..98336 98336


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

SpoVT-AbrB domain

(7-45)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 9621.03 Da        Isoelectric Point: 8.5444

>T290670 WP_001403920.1 NZ_LR890327:c38889-38614 [Escherichia coli]
VFSHRIVVSAITYSEMRFGASGPKASPRHVQLVDKFCPCLDAILSWDRAAVDGTTDIKVALRQAGTPIGQNDTAIAGPEA
GRLGKLTSPTL

Download         Length: 276 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8856.95 Da        Isoelectric Point: 4.6286

>AT290670 WP_001261274.1 NZ_LR890327:c39208-38978 [Escherichia coli]
MRTVSIFKNGNNRAIHLPRDLDFERVRELEIVREGDSIILRPVQPNWGSFAQLEKADPDFMAERENVVSDEGRFDL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB G3CAJ1

References