Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/ElaA-DUF1778 |
| Location | 37588..38391 | Replicon | plasmid 2 |
| Accession | NZ_LR890327 | ||
| Organism | Escherichia coli isolate MINF_1A-sc-2280431 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | G3CAI8 |
| Locus tag | JMV91_RS25435 | Protein ID | WP_000348883.1 |
| Coordinates | 37861..38391 (+) | Length | 177 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | G3CAI7 |
| Locus tag | JMV91_RS25430 | Protein ID | WP_001275013.1 |
| Coordinates | 37588..37857 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV91_RS25405 | 33733..34001 | + | 269 | Protein_43 | type II toxin-antitoxin system ParD family antitoxin | - |
| JMV91_RS25410 | 34117..34278 | + | 162 | WP_001440647.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| JMV91_RS25415 | 34345..34527 | + | 183 | WP_042004909.1 | hypothetical protein | - |
| JMV91_RS25420 | 34648..35388 | + | 741 | WP_001586233.1 | tyrosine-type recombinase/integrase | - |
| JMV91_RS25425 | 35711..36700 | - | 990 | WP_123002471.1 | RepB family plasmid replication initiator protein | - |
| JMV91_RS25430 | 37588..37857 | + | 270 | WP_001275013.1 | DUF1778 domain-containing protein | Antitoxin |
| JMV91_RS25435 | 37861..38391 | + | 531 | WP_000348883.1 | GNAT family N-acetyltransferase | Toxin |
| JMV91_RS25440 | 38392..38609 | + | 218 | Protein_50 | transposase | - |
| JMV91_RS25445 | 38614..38889 | - | 276 | WP_001403920.1 | type II toxin-antitoxin system VapC family toxin | - |
| JMV91_RS25450 | 38978..39208 | - | 231 | WP_001261274.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| JMV91_RS25455 | 39407..42028 | - | 2622 | WP_001586230.1 | hypothetical protein | - |
| JMV91_RS25460 | 42419..42904 | + | 486 | WP_001403958.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(B) / aadA5 / qacE / sul1 / mph(A) / aac(3)-IId / sul2 / aph(3'')-Ib / aph(6)-Id | - | 1..98336 | 98336 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 20321.20 Da Isoelectric Point: 6.4889
>T290669 WP_000348883.1 NZ_LR890327:37861-38391 [Escherichia coli]
MDGLRIEIFSEEVEYQLSNFDCGEEYLNTFLTDHLQRQHSSKILRGYLLVTREDRPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCDSL
FYPTKSIEVLFEVNDE
MDGLRIEIFSEEVEYQLSNFDCGEEYLNTFLTDHLQRQHSSKILRGYLLVTREDRPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCDSL
FYPTKSIEVLFEVNDE
Download Length: 531 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|