Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 30878..31437 Replicon plasmid 2
Accession NZ_LR890327
Organism Escherichia coli isolate MINF_1A-sc-2280431

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag JMV91_RS25385 Protein ID WP_000421272.1
Coordinates 31162..31437 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag JMV91_RS25380 Protein ID WP_001387467.1
Coordinates 30878..31162 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV91_RS25355 26341..26781 - 441 Protein_33 zinc-binding dehydrogenase -
JMV91_RS25360 27182..28072 + 891 WP_001077068.1 dihydrodipicolinate synthase family protein -
JMV91_RS25365 28097..28477 + 381 WP_023146450.1 Rid family detoxifying hydrolase -
JMV91_RS25370 28510..29475 + 966 WP_001022265.1 2-keto-3-deoxygluconate transporter -
JMV91_RS25375 29521..30273 - 753 WP_000562172.1 IclR family transcriptional regulator -
JMV91_RS25380 30878..31162 + 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
JMV91_RS25385 31162..31437 + 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
JMV91_RS25390 31543..31836 + 294 WP_001105060.1 hypothetical protein -
JMV91_RS25395 31871..31999 - 129 Protein_41 IS481 family transposase -
JMV91_RS25400 32032..33201 - 1170 WP_001072355.1 hypothetical protein -
JMV91_RS25405 33733..34001 + 269 Protein_43 type II toxin-antitoxin system ParD family antitoxin -
JMV91_RS25410 34117..34278 + 162 WP_001440647.1 type II toxin-antitoxin system RelE/ParE family toxin -
JMV91_RS25415 34345..34527 + 183 WP_042004909.1 hypothetical protein -
JMV91_RS25420 34648..35388 + 741 WP_001586233.1 tyrosine-type recombinase/integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(B) / aadA5 / qacE / sul1 / mph(A) / aac(3)-IId / sul2 / aph(3'')-Ib / aph(6)-Id - 1..98336 98336


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T290668 WP_000421272.1 NZ_LR890327:31162-31437 [Escherichia coli]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT290668 WP_001387467.1 NZ_LR890327:30878-31162 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References