Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 3786913..3787496 | Replicon | chromosome |
Accession | NZ_LR890326 | ||
Organism | Escherichia coli isolate MINF_1A-sc-2280431 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | V0SV58 |
Locus tag | JMV91_RS18440 | Protein ID | WP_000254750.1 |
Coordinates | 3786913..3787248 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | JMV91_RS18445 | Protein ID | WP_000581937.1 |
Coordinates | 3787248..3787496 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV91_RS18425 | 3782800..3784098 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
JMV91_RS18430 | 3784185..3785822 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
JMV91_RS18435 | 3786050..3786841 | - | 792 | WP_001071641.1 | nucleoside triphosphate pyrophosphohydrolase | - |
JMV91_RS18440 | 3786913..3787248 | - | 336 | WP_000254750.1 | endoribonuclease MazF | Toxin |
JMV91_RS18445 | 3787248..3787496 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
JMV91_RS18450 | 3787574..3789808 | - | 2235 | WP_000226795.1 | GTP diphosphokinase | - |
JMV91_RS18455 | 3789856..3791157 | - | 1302 | WP_000046808.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 3781417..3782745 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12067.95 Da Isoelectric Point: 8.2618
>T290663 WP_000254750.1 NZ_LR890326:c3787248-3786913 [Escherichia coli]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|