Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2825837..2826621 | Replicon | chromosome |
Accession | NZ_LR890326 | ||
Organism | Escherichia coli isolate MINF_1A-sc-2280431 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | JMV91_RS13865 | Protein ID | WP_000613626.1 |
Coordinates | 2826127..2826621 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B1LI61 |
Locus tag | JMV91_RS13860 | Protein ID | WP_001110446.1 |
Coordinates | 2825837..2826130 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV91_RS13850 | 2820998..2821957 | - | 960 | WP_000846337.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
JMV91_RS13855 | 2822530..2825703 | + | 3174 | WP_075591672.1 | ribonuclease E | - |
JMV91_RS13860 | 2825837..2826130 | + | 294 | WP_001110446.1 | DUF1778 domain-containing protein | Antitoxin |
JMV91_RS13865 | 2826127..2826621 | + | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
JMV91_RS13870 | 2826716..2827669 | - | 954 | WP_001212763.1 | flagellar hook-associated protein FlgL | - |
JMV91_RS13875 | 2827681..2829324 | - | 1644 | WP_000096448.1 | flagellar hook-associated protein FlgK | - |
JMV91_RS13880 | 2829390..2830331 | - | 942 | WP_012311956.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
JMV91_RS13885 | 2830331..2831428 | - | 1098 | WP_001441925.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T290662 WP_000613626.1 NZ_LR890326:2826127-2826621 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0T0H9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G775 |