Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2460446..2461084 | Replicon | chromosome |
Accession | NZ_LR890326 | ||
Organism | Escherichia coli isolate MINF_1A-sc-2280431 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | JMV91_RS12020 | Protein ID | WP_000813794.1 |
Coordinates | 2460908..2461084 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | JMV91_RS12015 | Protein ID | WP_001270286.1 |
Coordinates | 2460446..2460862 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV91_RS11995 | 2455598..2456539 | - | 942 | WP_001251303.1 | ABC transporter permease | - |
JMV91_RS12000 | 2456540..2457553 | - | 1014 | WP_000220391.1 | ABC transporter ATP-binding protein | - |
JMV91_RS12005 | 2457571..2458716 | - | 1146 | WP_000034364.1 | ABC transporter substrate-binding protein | - |
JMV91_RS12010 | 2458961..2460367 | - | 1407 | WP_000760611.1 | PLP-dependent aminotransferase family protein | - |
JMV91_RS12015 | 2460446..2460862 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
JMV91_RS12020 | 2460908..2461084 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
JMV91_RS12025 | 2461306..2461536 | + | 231 | WP_000491567.1 | DUF2554 family protein | - |
JMV91_RS12030 | 2461628..2463589 | - | 1962 | WP_012311648.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
JMV91_RS12035 | 2463662..2464198 | - | 537 | WP_000429154.1 | DNA-binding transcriptional regulator SutR | - |
JMV91_RS12040 | 2464251..2465171 | + | 921 | Protein_2345 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2465186..2466514 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T290661 WP_000813794.1 NZ_LR890326:c2461084-2460908 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT290661 WP_001270286.1 NZ_LR890326:c2460862-2460446 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|