Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 1513176..1513881 | Replicon | chromosome |
Accession | NZ_LR890326 | ||
Organism | Escherichia coli isolate MINF_1A-sc-2280431 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | JMV91_RS07190 | Protein ID | WP_000539521.1 |
Coordinates | 1513495..1513881 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | JMV91_RS07185 | Protein ID | WP_001280945.1 |
Coordinates | 1513176..1513505 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV91_RS07170 | 1508334..1509245 | + | 912 | WP_001236058.1 | glutathione ABC transporter permease GsiD | - |
JMV91_RS07175 | 1509422..1511770 | + | 2349 | WP_000950337.1 | EAL domain-containing protein | - |
JMV91_RS07180 | 1511778..1513106 | + | 1329 | WP_000086869.1 | GGDEF domain-containing protein | - |
JMV91_RS07185 | 1513176..1513505 | - | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
JMV91_RS07190 | 1513495..1513881 | - | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMV91_RS07195 | 1514107..1515432 | - | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
JMV91_RS07200 | 1515645..1516028 | + | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
JMV91_RS07205 | 1516139..1517254 | + | 1116 | WP_000555050.1 | aldose sugar dehydrogenase YliI | - |
JMV91_RS07210 | 1517251..1517877 | - | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T290655 WP_000539521.1 NZ_LR890326:c1513881-1513495 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|