Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 1124224..1125061 | Replicon | chromosome |
Accession | NZ_LR890326 | ||
Organism | Escherichia coli isolate MINF_1A-sc-2280431 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | V0SED1 |
Locus tag | JMV91_RS05315 | Protein ID | WP_000227787.1 |
Coordinates | 1124224..1124766 (-) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | B1LJI1 |
Locus tag | JMV91_RS05320 | Protein ID | WP_001353405.1 |
Coordinates | 1124750..1125061 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV91_RS05295 | 1119764..1120675 | - | 912 | WP_000705871.1 | 2-dehydropantoate 2-reductase | - |
JMV91_RS05300 | 1120843..1121334 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
JMV91_RS05305 | 1121462..1122826 | - | 1365 | WP_001000978.1 | MFS transporter | - |
JMV91_RS05310 | 1123233..1124168 | + | 936 | WP_012311701.1 | sel1 repeat family protein | - |
JMV91_RS05315 | 1124224..1124766 | - | 543 | WP_000227787.1 | GNAT family N-acetyltransferase | Toxin |
JMV91_RS05320 | 1124750..1125061 | - | 312 | WP_001353405.1 | DUF1778 domain-containing protein | Antitoxin |
JMV91_RS05325 | 1125246..1126136 | - | 891 | WP_000971336.1 | heme o synthase | - |
JMV91_RS05330 | 1126148..1126477 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
JMV91_RS05335 | 1126477..1127091 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
JMV91_RS05340 | 1127081..1129072 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
JMV91_RS05345 | 1129094..1130041 | - | 948 | WP_001239436.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19946.24 Da Isoelectric Point: 8.8951
>T290653 WP_000227787.1 NZ_LR890326:c1124766-1124224 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHRALPIKGVYLDADPAAINFYTRLGFVQLSA
RPNVFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHRALPIKGVYLDADPAAINFYTRLGFVQLSA
RPNVFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829GE43 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G7G3 |