Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 969330..970036 | Replicon | chromosome |
Accession | NZ_LR890326 | ||
Organism | Escherichia coli isolate MINF_1A-sc-2280431 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | V0SXW1 |
Locus tag | JMV91_RS04585 | Protein ID | WP_000854677.1 |
Coordinates | 969668..970036 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | V0SU84 |
Locus tag | JMV91_RS04580 | Protein ID | WP_000065824.1 |
Coordinates | 969330..969647 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV91_RS04555 | 966421..967598 | + | 1178 | WP_152895938.1 | IS3 family transposase | - |
JMV91_RS04560 | 967809..968045 | + | 237 | Protein_883 | DUF905 domain-containing protein | - |
JMV91_RS04565 | 968131..968589 | + | 459 | WP_000211834.1 | antirestriction protein | - |
JMV91_RS04570 | 968601..969080 | + | 480 | WP_000438147.1 | RadC family protein | - |
JMV91_RS04575 | 969089..969310 | + | 222 | WP_001220307.1 | DUF987 domain-containing protein | - |
JMV91_RS04580 | 969330..969647 | + | 318 | WP_000065824.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
JMV91_RS04585 | 969668..970036 | + | 369 | WP_000854677.1 | TA system toxin CbtA family protein | Toxin |
JMV91_RS04590 | 970829..971443 | + | 615 | WP_001019920.1 | YagU family protein | - |
JMV91_RS04595 | 971692..972021 | - | 330 | WP_001303809.1 | YkgJ family cysteine cluster protein | - |
JMV91_RS04600 | 972334..973044 | - | 711 | Protein_891 | fimbrial chaperone EcpE | - |
JMV91_RS04605 | 973013..974656 | - | 1644 | WP_001265639.1 | fimbrial adhesin EcpD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | yagV/ecpE / yagW/ecpD / yagX/ecpC / yagY/ecpB / yagZ/ecpA / ykgK/ecpR / fdeC | 959630..998367 | 38737 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13687.89 Da Isoelectric Point: 8.2671
>T290652 WP_000854677.1 NZ_LR890326:969668-970036 [Escherichia coli]
MKTLPATTPQAAKPCLSPVSVWQMLLTRLLEQHYGLMLSDTPFSDETVIKEHIDAGITLANAVNFLVEKYELVRIDRNGF
TSQVQAPYLTTTDILQARKACGLMSRCSYREVSNIVLSRSRL
MKTLPATTPQAAKPCLSPVSVWQMLLTRLLEQHYGLMLSDTPFSDETVIKEHIDAGITLANAVNFLVEKYELVRIDRNGF
TSQVQAPYLTTTDILQARKACGLMSRCSYREVSNIVLSRSRL
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|