Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 427757..428352 | Replicon | chromosome |
| Accession | NZ_LR890326 | ||
| Organism | Escherichia coli isolate MINF_1A-sc-2280431 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | V0SXT4 |
| Locus tag | JMV91_RS02145 | Protein ID | WP_000239581.1 |
| Coordinates | 428002..428352 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | L4JJX7 |
| Locus tag | JMV91_RS02140 | Protein ID | WP_001223213.1 |
| Coordinates | 427757..428008 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV91_RS02130 | 423422..427201 | + | 3780 | WP_000060872.1 | autotransporter assembly complex protein TamB | - |
| JMV91_RS02135 | 427204..427545 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| JMV91_RS02140 | 427757..428008 | + | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| JMV91_RS02145 | 428002..428352 | + | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
| JMV91_RS02150 | 428431..428961 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| JMV91_RS02155 | 429271..430227 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| JMV91_RS02160 | 430360..431862 | + | 1503 | WP_001095664.1 | sugar ABC transporter ATP-binding protein | - |
| JMV91_RS02165 | 431876..432898 | + | 1023 | WP_012311695.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T290650 WP_000239581.1 NZ_LR890326:428002-428352 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|