Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 70102..70745 | Replicon | plasmid 3 |
| Accession | NZ_LR890325 | ||
| Organism | Klebsiella pneumoniae isolate INF348-sc-2280170 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | JMW45_RS26275 | Protein ID | WP_048335684.1 |
| Coordinates | 70329..70745 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | JMW45_RS26270 | Protein ID | WP_001261276.1 |
| Coordinates | 70102..70332 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW45_RS26250 | 66225..67007 | - | 783 | WP_048235058.1 | site-specific integrase | - |
| JMW45_RS26255 | 67045..67392 | - | 348 | WP_074405026.1 | hypothetical protein | - |
| JMW45_RS26260 | 67754..68563 | - | 810 | WP_053059919.1 | hypothetical protein | - |
| JMW45_RS26265 | 68560..69480 | - | 921 | WP_201522427.1 | hypothetical protein | - |
| JMW45_RS26270 | 70102..70332 | + | 231 | WP_001261276.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| JMW45_RS26275 | 70329..70745 | + | 417 | WP_048335684.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JMW45_RS26280 | 70904..71509 | - | 606 | WP_000509966.1 | recombinase family protein | - |
| JMW45_RS26285 | 71604..74501 | + | 2898 | WP_023307208.1 | Tn3-like element Tn5403 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..137629 | 137629 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15079.57 Da Isoelectric Point: 7.8644
>T290648 WP_048335684.1 NZ_LR890325:70329-70745 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|