Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 69037..69773 | Replicon | plasmid 2 |
Accession | NZ_LR890324 | ||
Organism | Klebsiella pneumoniae isolate INF348-sc-2280170 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A8T5ZF70 |
Locus tag | JMW45_RS25535 | Protein ID | WP_004187044.1 |
Coordinates | 69037..69519 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | JMW45_RS25540 | Protein ID | WP_003026799.1 |
Coordinates | 69507..69773 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW45_RS25510 | 65061..65997 | - | 937 | Protein_60 | ISNCY family transposase | - |
JMW45_RS25515 | 66107..66277 | + | 171 | Protein_61 | transposase | - |
JMW45_RS25520 | 66275..66382 | + | 108 | Protein_62 | IS3 family transposase | - |
JMW45_RS25525 | 66616..67320 | - | 705 | WP_031591821.1 | toll/interleukin-1 receptor domain-containing protein | - |
JMW45_RS25530 | 67480..68826 | - | 1347 | WP_077251107.1 | ISNCY family transposase | - |
JMW45_RS25535 | 69037..69519 | - | 483 | WP_004187044.1 | GNAT family N-acetyltransferase | Toxin |
JMW45_RS25540 | 69507..69773 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
JMW45_RS25545 | 69924..70628 | + | 705 | WP_060579418.1 | IS6-like element IS26 family transposase | - |
JMW45_RS25550 | 70787..73372 | - | 2586 | WP_004187040.1 | EAL domain-containing protein | - |
JMW45_RS25555 | 73341..73586 | - | 246 | WP_032238678.1 | hypothetical protein | - |
JMW45_RS25560 | 73644..74624 | - | 981 | Protein_70 | IS5 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..138469 | 138469 | |
- | inside | IScluster/Tn | - | - | 58784..74624 | 15840 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17280.93 Da Isoelectric Point: 8.7197
>T290646 WP_004187044.1 NZ_LR890324:c69519-69037 [Klebsiella pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|