Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4507101..4507911 | Replicon | chromosome |
Accession | NZ_LR890323 | ||
Organism | Klebsiella pneumoniae isolate INF348-sc-2280170 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A060VJ83 |
Locus tag | JMW45_RS22175 | Protein ID | WP_004178461.1 |
Coordinates | 4507101..4507634 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | JMW45_RS22180 | Protein ID | WP_002887278.1 |
Coordinates | 4507645..4507911 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW45_RS22170 | 4505932..4507053 | + | 1122 | WP_023280822.1 | cupin domain-containing protein | - |
JMW45_RS22175 | 4507101..4507634 | - | 534 | WP_004178461.1 | GNAT family N-acetyltransferase | Toxin |
JMW45_RS22180 | 4507645..4507911 | - | 267 | WP_002887278.1 | DUF1778 domain-containing protein | Antitoxin |
JMW45_RS22185 | 4508014..4509447 | - | 1434 | WP_023280821.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
JMW45_RS22190 | 4509437..4510120 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
JMW45_RS22195 | 4510293..4511678 | + | 1386 | WP_032412712.1 | efflux transporter outer membrane subunit | - |
JMW45_RS22200 | 4511696..4512040 | + | 345 | WP_021441118.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19810.65 Da Isoelectric Point: 5.2614
>T290642 WP_004178461.1 NZ_LR890323:c4507634-4507101 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VJ83 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |