Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3916510..3917129 Replicon chromosome
Accession NZ_LR890323
Organism Klebsiella pneumoniae isolate INF348-sc-2280170

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag JMW45_RS19350 Protein ID WP_002892050.1
Coordinates 3916911..3917129 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag JMW45_RS19345 Protein ID WP_002892066.1
Coordinates 3916510..3916884 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW45_RS19335 3911662..3912855 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
JMW45_RS19340 3912878..3916024 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
JMW45_RS19345 3916510..3916884 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
JMW45_RS19350 3916911..3917129 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
JMW45_RS19355 3917292..3917858 + 567 WP_002892030.1 maltose O-acetyltransferase -
JMW45_RS19360 3917830..3917970 - 141 WP_004147370.1 hypothetical protein -
JMW45_RS19365 3917991..3918461 + 471 WP_002892026.1 YlaC family protein -
JMW45_RS19370 3918436..3919887 - 1452 WP_021313732.1 PLP-dependent aminotransferase family protein -
JMW45_RS19375 3919988..3920686 + 699 WP_002892021.1 GNAT family N-acetyltransferase -
JMW45_RS19380 3920683..3920823 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
JMW45_RS19385 3920823..3921086 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T290641 WP_002892050.1 NZ_LR890323:3916911-3917129 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT290641 WP_002892066.1 NZ_LR890323:3916510-3916884 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References