Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 728326..729104 | Replicon | chromosome |
Accession | NZ_LR890323 | ||
Organism | Klebsiella pneumoniae isolate INF348-sc-2280170 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | JMW45_RS03670 | Protein ID | WP_031591140.1 |
Coordinates | 728616..729104 (+) | Length | 163 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | JMW45_RS03665 | Protein ID | WP_004150912.1 |
Coordinates | 728326..728619 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW45_RS03645 | 723534..724136 | - | 603 | WP_004174410.1 | short chain dehydrogenase | - |
JMW45_RS03650 | 724234..725145 | + | 912 | WP_004181308.1 | LysR family transcriptional regulator | - |
JMW45_RS03655 | 725146..726294 | - | 1149 | WP_004174416.1 | PLP-dependent aspartate aminotransferase family protein | - |
JMW45_RS03660 | 726305..727681 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
JMW45_RS03665 | 728326..728619 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
JMW45_RS03670 | 728616..729104 | + | 489 | WP_031591140.1 | GNAT family N-acetyltransferase | Toxin |
JMW45_RS03675 | 729185..731617 | - | 2433 | Protein_722 | hypothetical protein | - |
JMW45_RS03680 | 731618..732586 | + | 969 | WP_080465744.1 | IS5 family transposase | - |
JMW45_RS03685 | 732626..733807 | - | 1182 | Protein_724 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 163 a.a. Molecular weight: 17604.53 Da Isoelectric Point: 7.7754
>T290634 WP_031591140.1 NZ_LR890323:728616-729104 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCGSDSNVLAYYSLASSAVMTNTAPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYLRVGFEPSPMDPMMLMVTLGDLV
HA
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCGSDSNVLAYYSLASSAVMTNTAPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYLRVGFEPSPMDPMMLMVTLGDLV
HA
Download Length: 489 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|