Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 657585..658264 | Replicon | chromosome |
Accession | NZ_LR890323 | ||
Organism | Klebsiella pneumoniae isolate INF348-sc-2280170 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | JMW45_RS03300 | Protein ID | WP_201522333.1 |
Coordinates | 657923..658264 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | JMW45_RS03295 | Protein ID | WP_201522332.1 |
Coordinates | 657585..657902 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW45_RS03250 | 652933..653550 | + | 618 | Protein_638 | DUF945 domain-containing protein | - |
JMW45_RS03255 | 653759..654469 | + | 711 | WP_201522328.1 | DeoR family transcriptional regulator | - |
JMW45_RS03260 | 654495..655031 | + | 537 | WP_201522329.1 | DUF4339 domain-containing protein | - |
JMW45_RS03265 | 655073..655510 | + | 438 | WP_023301392.1 | hypothetical protein | - |
JMW45_RS03270 | 655577..655987 | + | 411 | WP_064411433.1 | hypothetical protein | - |
JMW45_RS03275 | 656065..656301 | + | 237 | WP_064411434.1 | DUF905 domain-containing protein | - |
JMW45_RS03280 | 656387..656845 | + | 459 | WP_023301394.1 | antirestriction protein | - |
JMW45_RS03285 | 656854..657336 | + | 483 | WP_201522330.1 | RadC family protein | - |
JMW45_RS03290 | 657345..657566 | + | 222 | WP_201522331.1 | DUF987 domain-containing protein | - |
JMW45_RS03295 | 657585..657902 | + | 318 | WP_201522332.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
JMW45_RS03300 | 657923..658264 | + | 342 | WP_201522333.1 | TA system toxin CbtA family protein | Toxin |
JMW45_RS03310 | 658626..659132 | + | 507 | WP_002917636.1 | G/U mismatch-specific DNA glycosylase | - |
JMW45_RS03315 | 659231..661072 | - | 1842 | WP_004174339.1 | RNA polymerase sigma factor RpoD | - |
JMW45_RS03320 | 661291..663036 | - | 1746 | WP_201522334.1 | DNA primase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 635891..658264 | 22373 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12910.01 Da Isoelectric Point: 10.3872
>T290633 WP_201522333.1 NZ_LR890323:657923-658264 [Klebsiella pneumoniae]
MKTLSATISRAAKPCLSPVAVWQMLLTRLLEKHYALTLNDTPFGDERVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRKNSVR
MKTLSATISRAAKPCLSPVAVWQMLLTRLLEKHYALTLNDTPFGDERVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRKNSVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|