Detailed information of TA system
Overview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 4104318..4105024 | Replicon | chromosome |
Accession | NZ_LR890317 | ||
Organism | Klebsiella pneumoniae isolate INF215-sc-2280087 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | JMX39_RS20280 | Protein ID | WP_024622903.1 |
Coordinates | 4104656..4105024 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A485WAM6 |
Locus tag | JMX39_RS20275 | Protein ID | WP_023302278.1 |
Coordinates | 4104318..4104635 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX39_RS20230 | 4099459..4100283 | + | 825 | WP_023302271.1 | DUF945 domain-containing protein | - |
JMX39_RS20235 | 4100492..4101202 | + | 711 | WP_023302272.1 | DeoR family transcriptional regulator | - |
JMX39_RS20240 | 4101228..4101764 | + | 537 | WP_023302273.1 | DUF4339 domain-containing protein | - |
JMX39_RS20245 | 4101806..4102243 | + | 438 | WP_023301392.1 | hypothetical protein | - |
JMX39_RS20250 | 4102310..4102720 | + | 411 | WP_023302274.1 | hypothetical protein | - |
JMX39_RS20255 | 4102798..4103034 | + | 237 | WP_032410024.1 | DUF905 domain-containing protein | - |
JMX39_RS20260 | 4103121..4103579 | + | 459 | WP_023302275.1 | antirestriction protein | - |
JMX39_RS20265 | 4103588..4104070 | + | 483 | WP_023302276.1 | RadC family protein | - |
JMX39_RS20270 | 4104079..4104300 | + | 222 | WP_023302277.1 | DUF987 domain-containing protein | - |
JMX39_RS20275 | 4104318..4104635 | + | 318 | WP_023302278.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
JMX39_RS20280 | 4104656..4105024 | + | 369 | WP_024622903.1 | TA system toxin CbtA family protein | Toxin |
JMX39_RS20285 | 4105021..4105362 | + | 342 | WP_024622904.1 | hypothetical protein | - |
JMX39_RS20290 | 4105485..4108130 | - | 2646 | WP_024622905.1 | LuxR family transcriptional regulator | - |
JMX39_RS20295 | 4108504..4109463 | + | 960 | WP_023302280.1 | thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13651.82 Da Isoelectric Point: 7.2897
>T290623 WP_024622903.1 NZ_LR890317:4104656-4105024 [Klebsiella pneumoniae]
MKNLPATISQAAKPCLSPVAVWQMLLTHLLEQHYGLMLSDTPFSDEAVIQEHIDAGITLANAVNFLVEKYELVRIDRCGF
SSQVQAPYLTATDILHARKACGLMSRYSYREVSNIVLSRSRI
MKNLPATISQAAKPCLSPVAVWQMLLTHLLEQHYGLMLSDTPFSDEAVIQEHIDAGITLANAVNFLVEKYELVRIDRCGF
SSQVQAPYLTATDILHARKACGLMSRYSYREVSNIVLSRSRI
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|