Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 5138270..5138928 | Replicon | chromosome |
| Accession | NZ_LR890312 | ||
| Organism | Klebsiella oxytoca isolate MSB1_10D-sc-2280340 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | - |
| Locus tag | JMX52_RS23945 | Protein ID | WP_201621101.1 |
| Coordinates | 5138270..5138590 (-) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | JMX52_RS23950 | Protein ID | WP_201621102.1 |
| Coordinates | 5138611..5138928 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX52_RS23925 | 5134514..5135218 | + | 705 | WP_032726119.1 | DNA/RNA non-specific endonuclease | - |
| JMX52_RS23930 | 5135507..5135830 | + | 324 | WP_023320260.1 | endoribonuclease SymE | - |
| JMX52_RS23935 | 5135977..5136411 | + | 435 | WP_023320259.1 | VOC family protein | - |
| JMX52_RS23940 | 5137029..5138162 | + | 1134 | WP_201621100.1 | hypothetical protein | - |
| JMX52_RS23945 | 5138270..5138590 | - | 321 | WP_201621101.1 | TA system toxin CbtA family protein | Toxin |
| JMX52_RS23950 | 5138611..5138928 | - | 318 | WP_201621102.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| JMX52_RS23955 | 5138946..5139167 | - | 222 | WP_110123787.1 | DUF987 domain-containing protein | - |
| JMX52_RS23960 | 5139176..5139658 | - | 483 | WP_201621103.1 | DNA repair protein RadC | - |
| JMX52_RS23965 | 5139667..5140125 | - | 459 | WP_201621104.1 | antirestriction protein | - |
| JMX52_RS23970 | 5140212..5140448 | - | 237 | WP_201621105.1 | DUF905 domain-containing protein | - |
| JMX52_RS23975 | 5140526..5140936 | - | 411 | WP_201621106.1 | hypothetical protein | - |
| JMX52_RS23980 | 5141003..5141440 | - | 438 | WP_201621107.1 | hypothetical protein | - |
| JMX52_RS23985 | 5141482..5142018 | - | 537 | WP_201621108.1 | DUF4339 domain-containing protein | - |
| JMX52_RS23990 | 5142044..5142754 | - | 711 | WP_201621109.1 | transcriptional regulator | - |
| JMX52_RS23995 | 5142963..5143787 | - | 825 | WP_201621110.1 | DUF945 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 5135507..5167957 | 32450 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12034.78 Da Isoelectric Point: 6.4564
>T290611 WP_201621101.1 NZ_LR890312:c5138590-5138270 [Klebsiella oxytoca]
MKNLPATVSRATKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLTDAVNFLVDKYELVRTDRRGF
SWQEQSPYLQVVDILWARQAIGSSSK
MKNLPATVSRATKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLTDAVNFLVDKYELVRTDRRGF
SWQEQSPYLQVVDILWARQAIGSSSK
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|