Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4375027..4375646 | Replicon | chromosome |
| Accession | NZ_LR890312 | ||
| Organism | Klebsiella oxytoca isolate MSB1_10D-sc-2280340 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H3N9D8 |
| Locus tag | JMX52_RS20465 | Protein ID | WP_004099646.1 |
| Coordinates | 4375428..4375646 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | JMX52_RS20460 | Protein ID | WP_004099648.1 |
| Coordinates | 4375027..4375401 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX52_RS20450 | 4370183..4371376 | + | 1194 | WP_004111040.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| JMX52_RS20455 | 4371399..4374545 | + | 3147 | WP_004099650.1 | multidrug efflux RND transporter permease subunit | - |
| JMX52_RS20460 | 4375027..4375401 | + | 375 | WP_004099648.1 | Hha toxicity modulator TomB | Antitoxin |
| JMX52_RS20465 | 4375428..4375646 | + | 219 | WP_004099646.1 | hemolysin expression modulator Hha | Toxin |
| JMX52_RS20470 | 4375807..4376373 | + | 567 | WP_023320460.1 | maltose O-acetyltransferase | - |
| JMX52_RS20475 | 4376510..4376980 | + | 471 | WP_004111038.1 | YlaC family protein | - |
| JMX52_RS20480 | 4376955..4378409 | - | 1455 | WP_023320459.1 | PLP-dependent aminotransferase family protein | - |
| JMX52_RS20485 | 4378511..4379209 | + | 699 | WP_004099639.1 | GNAT family N-acetyltransferase | - |
| JMX52_RS20490 | 4379206..4379346 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| JMX52_RS20495 | 4379346..4379609 | - | 264 | WP_004099638.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T290609 WP_004099646.1 NZ_LR890312:4375428-4375646 [Klebsiella oxytoca]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14350.09 Da Isoelectric Point: 4.8989
>AT290609 WP_004099648.1 NZ_LR890312:4375027-4375401 [Klebsiella oxytoca]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|