Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4664902..4665418 | Replicon | chromosome |
Accession | NZ_LR890307 | ||
Organism | Klebsiella pneumoniae isolate INF188-sc-2280054 |
Toxin (Protein)
Gene name | relE | Uniprot ID | J2XDK6 |
Locus tag | JMW12_RS22870 | Protein ID | WP_002886902.1 |
Coordinates | 4664902..4665186 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | JMW12_RS22875 | Protein ID | WP_002886901.1 |
Coordinates | 4665176..4665418 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW12_RS22845 | 4660318..4660626 | - | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
JMW12_RS22850 | 4660711..4660884 | + | 174 | WP_032410138.1 | hypothetical protein | - |
JMW12_RS22855 | 4660887..4661630 | + | 744 | WP_021441079.1 | MurR/RpiR family transcriptional regulator | - |
JMW12_RS22860 | 4661987..4664125 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
JMW12_RS22865 | 4664434..4664898 | + | 465 | WP_023302390.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
JMW12_RS22870 | 4664902..4665186 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMW12_RS22875 | 4665176..4665418 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
JMW12_RS22880 | 4665496..4667406 | - | 1911 | WP_009486549.1 | BglG family transcription antiterminator | - |
JMW12_RS22885 | 4667429..4668583 | - | 1155 | WP_085808042.1 | lactonase family protein | - |
JMW12_RS22890 | 4668650..4669390 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T290598 WP_002886902.1 NZ_LR890307:c4665186-4664902 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GMH2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |