Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3944180..3944799 Replicon chromosome
Accession NZ_LR890307
Organism Klebsiella pneumoniae isolate INF188-sc-2280054

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag JMW12_RS19400 Protein ID WP_002892050.1
Coordinates 3944581..3944799 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag JMW12_RS19395 Protein ID WP_002892066.1
Coordinates 3944180..3944554 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW12_RS19385 3939332..3940525 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
JMW12_RS19390 3940548..3943694 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
JMW12_RS19395 3944180..3944554 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
JMW12_RS19400 3944581..3944799 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
JMW12_RS19405 3944958..3945524 + 567 WP_002892030.1 maltose O-acetyltransferase -
JMW12_RS19410 3945496..3945636 - 141 WP_004147370.1 hypothetical protein -
JMW12_RS19415 3945657..3946127 + 471 WP_002892026.1 YlaC family protein -
JMW12_RS19420 3946102..3947553 - 1452 WP_023302231.1 PLP-dependent aminotransferase family protein -
JMW12_RS19425 3947654..3948352 + 699 WP_002892021.1 GNAT family N-acetyltransferase -
JMW12_RS19430 3948349..3948489 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
JMW12_RS19435 3948489..3948752 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T290596 WP_002892050.1 NZ_LR890307:3944581-3944799 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT290596 WP_002892066.1 NZ_LR890307:3944180-3944554 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References