290587

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 10686..11151 Replicon plasmid 5
Accession NZ_LR890303
Organism Escherichia coli isolate MSB1_3B-sc-2280406

Toxin (Protein)


Gene name TsxA Uniprot ID U9ZUY2
Locus tag JM188_RS26440 Protein ID WP_001230707.1
Coordinates 10900..11151 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID M7CCF8
Locus tag JM188_RS26435 Protein ID WP_000801440.1
Coordinates 10686..10913 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JM188_RS26390 6007..6240 - 234 WP_000121161.1 EexN family lipoprotein -
JM188_RS26395 6245..6511 - 267 WP_000160395.1 hypothetical protein -
JM188_RS26400 6588..7817 - 1230 WP_001694183.1 relaxase/mobilization nuclease domain-containing protein -
JM188_RS26405 7829..8329 - 501 WP_001694182.1 hypothetical protein -
JM188_RS26410 8693..9040 - 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin -
JM188_RS26415 9037..9285 - 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin -
JM188_RS26420 9592..9897 - 306 WP_072182957.1 hypothetical protein -
JM188_RS26425 9965..10237 - 273 WP_001272373.1 hypothetical protein -
JM188_RS26430 10239..10591 - 353 Protein_13 molecular chaperone DnaJ -
JM188_RS26435 10686..10913 - 228 WP_000801440.1 hypothetical protein Antitoxin
JM188_RS26440 10900..11151 - 252 WP_001230707.1 hypothetical protein Toxin
JM188_RS26445 11148..11690 - 543 WP_001083906.1 hypothetical protein -
JM188_RS26450 11795..12310 - 516 WP_001025395.1 J domain-containing protein -
JM188_RS26455 13726..14592 + 867 WP_053911940.1 replication initiation protein -
JM188_RS26460 14605..15009 + 405 WP_000654311.1 hypothetical protein -
JM188_RS26465 15144..15671 + 528 WP_000577044.1 DUF2726 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..30638 30638


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9751.13 Da        Isoelectric Point: 8.9187

>T290587 WP_001230707.1 NZ_LR890303:c11151-10900 [Escherichia coli]
MRKNKGDVTYFLEKEGDNYRLTKRIKARTNVKIGNKTTKITLYDAVLNENELQHIDFTCAGLREDDETPVKNLIKEFMLN
ETR

Download         Length: 252 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8659.98 Da        Isoelectric Point: 8.5105

>AT290587 WP_000801440.1 NZ_LR890303:c10913-10686 [Escherichia coli]
MKPDNTPENVKKLRLKAGLTQKECSHIYGVGLRTWQKKEEVNTQNSQSLSLVEFEFLLLLAGEHPEYVLCKRESK

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9ZUY2

Antitoxin

Source ID Structure
AlphaFold DB A0A5Y6U8W9

References