Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1219876..1220660 | Replicon | chromosome |
| Accession | NZ_LR890299 | ||
| Organism | Escherichia coli isolate MSB1_3B-sc-2280406 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | V0T0H9 |
| Locus tag | JM188_RS06050 | Protein ID | WP_000613626.1 |
| Coordinates | 1220166..1220660 (+) | Length | 165 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | L4JCW6 |
| Locus tag | JM188_RS06045 | Protein ID | WP_001110447.1 |
| Coordinates | 1219876..1220169 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JM188_RS06035 | 1215026..1215985 | - | 960 | WP_000846342.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
| JM188_RS06040 | 1216558..1219743 | + | 3186 | WP_001550951.1 | ribonuclease E | - |
| JM188_RS06045 | 1219876..1220169 | + | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
| JM188_RS06050 | 1220166..1220660 | + | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
| JM188_RS06055 | 1220755..1221708 | - | 954 | WP_001212768.1 | flagellar hook-associated protein FlgL | - |
| JM188_RS06060 | 1221720..1223363 | - | 1644 | WP_000096478.1 | flagellar hook-associated protein FlgK | - |
| JM188_RS06065 | 1223429..1224370 | - | 942 | WP_001366226.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
| JM188_RS06070 | 1224370..1225467 | - | 1098 | WP_001441925.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T290553 WP_000613626.1 NZ_LR890299:1220166-1220660 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|