290546

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 6858..7351 Replicon plasmid 5
Accession NZ_LR890295
Organism Klebsiella pneumoniae strain KSB1_1B

Toxin (Protein)


Gene name TsxA Uniprot ID U9Y9W8
Locus tag JMW65_RS27265 Protein ID WP_001230709.1
Coordinates 6858..7112 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag JMW65_RS27270 Protein ID WP_000151456.1
Coordinates 7109..7351 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW65_RS27230 2433..2594 + 162 WP_001434039.1 type I toxin-antitoxin system Hok family toxin -
JMW65_RS27235 2743..3339 + 597 WP_000125165.1 hypothetical protein -
JMW65_RS27240 3357..3641 - 285 WP_001162371.1 hypothetical protein -
JMW65_RS27245 3715..4380 - 666 WP_015387337.1 P-loop NTPase -
JMW65_RS27250 4967..5296 + 330 WP_000855119.1 hypothetical protein -
JMW65_RS27255 5700..6215 + 516 WP_001025393.1 J domain-containing protein -
JMW65_RS27260 6319..6861 + 543 WP_001083904.1 hypothetical protein -
JMW65_RS27265 6858..7112 + 255 WP_001230709.1 hypothetical protein Toxin
JMW65_RS27270 7109..7351 + 243 WP_000151456.1 hypothetical protein Antitoxin
JMW65_RS27275 7488..7820 + 333 WP_001393253.1 WbuC family cupin fold metalloprotein -
JMW65_RS27280 7867..8742 - 876 WP_015387340.1 class A extended-spectrum beta-lactamase CTX-M-55 -
JMW65_RS27285 8995..10257 - 1263 WP_000608644.1 IS1380-like element ISEc9 family transposase -
JMW65_RS27290 11007..11294 + 288 WP_000673430.1 hypothetical protein -
JMW65_RS27295 11304..11720 + 417 WP_053882499.1 phage tail protein -
JMW65_RS27300 11717..12028 + 312 WP_001310436.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaCTX-M-55 - 1..62194 62194
- flank IS/Tn blaCTX-M-55 - 7867..10257 2390


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9942.47 Da        Isoelectric Point: 10.1206

>T290546 WP_001230709.1 NZ_LR890295:6858-7112 [Klebsiella pneumoniae]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT290546 WP_000151456.1 NZ_LR890295:7109-7351 [Klebsiella pneumoniae]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G9H8F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References