Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 79584..80320 | Replicon | plasmid 2 |
Accession | NZ_LR890292 | ||
Organism | Klebsiella pneumoniae strain KSB1_1B |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A8T5ZF70 |
Locus tag | JMW65_RS26025 | Protein ID | WP_004187044.1 |
Coordinates | 79838..80320 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | JMW65_RS26020 | Protein ID | WP_003026799.1 |
Coordinates | 79584..79850 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW65_RS26000 | 74733..75713 | + | 981 | Protein_76 | IS5 family transposase | - |
JMW65_RS26005 | 75771..76016 | + | 246 | WP_032238678.1 | hypothetical protein | - |
JMW65_RS26010 | 75985..78570 | + | 2586 | WP_004187040.1 | EAL domain-containing protein | - |
JMW65_RS26015 | 78729..79433 | - | 705 | WP_060579418.1 | IS6-like element IS26 family transposase | - |
JMW65_RS26020 | 79584..79850 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
JMW65_RS26025 | 79838..80320 | + | 483 | WP_004187044.1 | GNAT family N-acetyltransferase | Toxin |
JMW65_RS26030 | 80478..82010 | - | 1533 | WP_015065592.1 | IS3-like element ISKpn38 family transposase | - |
JMW65_RS26035 | 82133..83479 | + | 1347 | WP_077251107.1 | ISNCY family transposase | - |
JMW65_RS26040 | 83639..84343 | + | 705 | WP_031591821.1 | toll/interleukin-1 receptor domain-containing protein | - |
JMW65_RS26045 | 84577..84684 | - | 108 | Protein_85 | IS3 family transposase | - |
JMW65_RS26050 | 84682..84852 | - | 171 | Protein_86 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..133165 | 133165 | |
- | inside | IScluster/Tn | - | - | 74733..85919 | 11186 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17280.93 Da Isoelectric Point: 8.7197
>T290545 WP_004187044.1 NZ_LR890292:79838-80320 [Klebsiella pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|