Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 66167..66689 | Replicon | plasmid 2 |
Accession | NZ_LR890292 | ||
Organism | Klebsiella pneumoniae strain KSB1_1B |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A9J6S4Z8 |
Locus tag | JMW65_RS25935 | Protein ID | WP_004187019.1 |
Coordinates | 66167..66451 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A2J4ZSR4 |
Locus tag | JMW65_RS25940 | Protein ID | WP_004187025.1 |
Coordinates | 66441..66689 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW65_RS25910 | 61386..61850 | - | 465 | WP_004187010.1 | hypothetical protein | - |
JMW65_RS25915 | 63393..63917 | + | 525 | Protein_59 | hypothetical protein | - |
JMW65_RS25920 | 63934..64417 | + | 484 | Protein_60 | hypothetical protein | - |
JMW65_RS25925 | 64415..64714 | + | 300 | Protein_61 | conjugal transfer protein TraH | - |
JMW65_RS25930 | 64796..66151 | + | 1356 | WP_004187017.1 | ISNCY family transposase | - |
JMW65_RS25935 | 66167..66451 | - | 285 | WP_004187019.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMW65_RS25940 | 66441..66689 | - | 249 | WP_004187025.1 | plasmid stabilization protein | Antitoxin |
JMW65_RS25945 | 66979..67403 | - | 425 | Protein_65 | IS1 family transposase | - |
JMW65_RS25950 | 67591..67707 | - | 117 | Protein_66 | transposase domain-containing protein | - |
JMW65_RS25955 | 67652..67915 | - | 264 | WP_004187027.1 | transposase | - |
JMW65_RS25960 | 67930..68193 | + | 264 | WP_004118208.1 | hypothetical protein | - |
JMW65_RS25965 | 68437..68718 | + | 282 | WP_013307885.1 | helix-turn-helix domain-containing protein | - |
JMW65_RS25970 | 68753..69322 | + | 570 | WP_004152117.1 | small heat shock protein sHSP20 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..133165 | 133165 | |
- | flank | IS/Tn | - | - | 67128..67352 | 224 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11003.72 Da Isoelectric Point: 10.5388
>T290544 WP_004187019.1 NZ_LR890292:c66451-66167 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTLQVQFKKKLKERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYRVEDDIVTVTVIGVGK
RENDDIYNATLNRN
MTYKLAFNESALKEWKKLGHTLQVQFKKKLKERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYRVEDDIVTVTVIGVGK
RENDDIYNATLNRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|